PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G17500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 294aa    MW: 31355.4 Da    PI: 7.4436
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G17500.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l+ +v+++G+g+W++++ + g+ R+ k+c++rw +yl
  OMERI03G17500.1 14 KGPWTPEEDMVLASYVQEHGPGNWRAVPPRTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding43.86.1e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++  E+ l++++ ++lG++ W++Ia++++ +Rt++++k++w+++l
  OMERI03G17500.1  67 RGGFSHHEERLILHLQALLGNR-WAAIASYLP-HRTDNDVKNFWNTHL 112
                      7889******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-23564IPR009057Homeodomain-like
PROSITE profilePS5129422.963965IPR017930Myb domain
SuperFamilySSF466892.42E-2911108IPR009057Homeodomain-like
SMARTSM007171.7E-131363IPR001005SANT/Myb domain
PfamPF002497.6E-161461IPR001005SANT/Myb domain
CDDcd001674.12E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.5E-2265116IPR009057Homeodomain-like
PROSITE profilePS5129418.35666116IPR017930Myb domain
SMARTSM007171.9E-1466114IPR001005SANT/Myb domain
PfamPF002491.8E-1267112IPR001005SANT/Myb domain
CDDcd001671.00E-1070111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGRPPCCEKE GVKKGPWTPE EDMVLASYVQ EHGPGNWRAV PPRTGLLRCS KSCRLRWTNY  60
LRPGIRRGGF SHHEERLILH LQALLGNRWA AIASYLPHRT DNDVKNFWNT HLKKKLALSS  120
SSSSPATPIV ARGQWERKLQ TDIDLARRAL RDALSVSQHQ PEPTTPAISS SGPPAPAAAA  180
YALSERNISM MLSGWAAPPG KGSAVVSGAA ESASTAGTSS ELTGADCCSG ASSASNCLPS  240
SMLLACDDGD ATAMAAGVAP LSAIESWLLL DDSGEPQLAL DEQLLDVALR NYAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-241411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0847620.0AC084762.8 Oryza sativa chromosome 3 BAC OSJNBa0013O08 genomic sequence, complete sequence.
GenBankAF4741360.0AF474136.1 Oryza sativa typical P-type R2R3 Myb protein gene, partial cds.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630096.11e-166PREDICTED: myb-related protein 306-like
SwissprotP813921e-94MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0E0D1B30.0A0A0E0D1B3_9ORYZ; Uncharacterized protein
STRINGORGLA03G0181800.11e-167(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.16e-79myb domain protein 94